My ExportersIndia

For Buyer

For Seller

For Help

Shenzhen Sumring Technology

Shenzhen Sumring Technology
location shenzhen, United States

Write a Review

Our Products

  1. Spying & Intelligence Devices 41 Products available
  2. Security Alarms & Devices 16 Products available
  3. Safety System & Equipments 5 Products available
  4. Fire Alarm System 3 Products available
  5. Testing Equipment 2 Products available
  6. Fire Fighting & Protection 2 Products available
  7. Piezo Siren 2 Products available
  8. Sensors 1 Products available
  9. Stage Lights 1 Products available
  10. Speakers 1 Products available
  11. Optical Sensors 1 Products available

Safety System & Equipments

Our offered Product range includes Fire and Gas Detectors Alarm, Home Combustible Natural Gas Leak Detector Alarm, DC Power Network LPG Multi Gas Detector Alarm, Gas Leak Detector Alarm and Natural Gas Alarm with CO Sensor.

Fire And Gas Detectors Alarm Natural Gas Detector Multi Gas Detector Alarm

633.50 - 1,086 / Piece Get Latest Price
  • Min. Order (MOQ) 1 Piece(s)
  • Number Of Flower Gas Detector
  • Material ABS Plastic
  • Feature Accuracy, Alarm System, Durable, Easy To Use, Eco Friendly, Rechargeable, Stable Performance
  • Condition New
  • Application Gas Detecting
  • Total Carbohydrate 2Year
  • Gas Type Combustible Gas, LPG Gas, Natural Gas

Advancedsemiconductorsensorisadoptedforthelpggassensor.Thelpg/naturalgassensorcanbedetectedlight/soundbythemethodofalarm.itiscanbeusedasindependentfamilygasalarmequipment.Herearethemainfutures:
1.Highstabilitysensor2.Autoself-checkfunction3.Autoresetfunction

Additional Information:

Payment Terms : L/C, D/A, D/P, T/T, Western Union, ,

Packaging Details : Advanced semiconductor sensor is adopted for the lpg gas sensor. The lpg/natural gas sensor can be detected light/sound by the method of alarm.it is can be used as independent family gas alarm equipment.
Here are the main futures :

1.High stability sensor
2.Auto self-check function
3.Auto reset function
4.the lp gas detector with SMT design
5.Microprocessor adopted

Delivery Time : 5-7days

View Complete Details

Home Combustible Best Natural Gas Leak Detector Alarm With 9v Battery

633.50 - 1,086 / Piece Get Latest Price
  • Min. Order (MOQ) 1 Piece(s)
  • Number Of Flower Gas Alarm
  • Material ABS
  • Application Home, Office, Shop
  • Condition New
  • Feature Durable, Easy To Install, Eco Friendly, High Accuracy, High Volume, Waterproof
  • Total Carbohydrate 2Year
  • Brand Name Sumring
  • Application Gas Leak Alarm
  • Detected gas Lgp Gas/natural Gas/CH4

The product(SR-908NSZ) is a smart combustible gas leak detector with voice prompt, microprocessor control, support displaying of the gas concentration. When trigger the gas detector, it will alarm with build-in siren. This detector adopt catalytic combustion method sensor which is stable and reliable. It keeps the place safe from the threats of combustible gas (such as liquefied petroleum gas, natural gas, pipeline gas, biogas, methane etc.)

Additional Information:

Payment Terms : L/C, D/A, D/P, T/T, Western Union

Packaging Details :

Delivery Time : 5-7days

View Complete Details

DC Power Network LPG Multi Gas Detector Alarm Gas Detector For Home

362 - 543 / Piece Get Latest Price
  • Min. Order (MOQ) 1 Piece(s)
  • Number Of Flower Lpg Gas Detector
  • Material ABS Plastic
  • Certification CE Certified
  • Feature Accuracy, Durable, Easy To Use, Eco Friendly, Rechargeable, Stable Performance
  • Application LPG Gas Detecting
  • Total Carbohydrate 2Year
  • Gas Type LPG Gas
  • Brand Name Sumring
  • Country of Origin DC9-24V

main features:

high reliability sensor/mcu processing

combustible gas detector, network/auto reset function

malfunction auto-check indicator

detect natural gas or lpg

sound &led flash alarm output:

execute criterion: gb15322, ul1484, en50194

.

Additional Information:

Payment Terms : L/C, D/A, D/P, T/T, Western Union,

Packaging Details : Main features:
High reliability sensor/MCU processing
Combustible gas detector, network/Auto reset function
Malfunction auto-check indicator
Detect natural gas or LPG
Sound &LED flash alarm output:
Execute criterion: GB15322, UL1484, EN50194

Delivery Time : 5-7days

View Complete Details

Best Gas Leak Detector Price Gas Leak Alarm LPG Gas Detector For Home Safety

362 - 633.50 / Piece Get Latest Price
  • Min. Order (MOQ) 1 Piece(s)
  • Number Of Flower Gas Leak Detector
  • Material ABS Plastic
  • Certification CE Certified
  • Feature Accuracy, Durable, Easy To Use, Eco Friendly, Stable Performance
  • Condition New
  • Total Carbohydrate 2Year
  • Gas Type Combustible Gas, LPG Gas, Natural Gas

Best gas leak detector price gas leak alarm lpg gas detector for home safety

network, Low power consumption design

Combustible gas detector, network

High reliability sensor, Auto reset

MCU processing

Malfunction auto-check indicator

Detect natural gas or LPG

Sound &LED flash alarm output

Additional Information:

Payment Terms : L/C, D/A, D/P, T/T, Western Union,

Delivery Time : 5-7days

View Complete Details
Tell Us What are you looking for? Will call you back

Contact Us