My ExportersIndia

For Buyer

For Seller

For Help

Dietary Supplements & Nutraceuticals

Leading Manufacturer, Supplier & Retailer of Growth Hormone Releasing Peptides, Ghrp Releasing Peptide, Cjc, Human Growth Hormone Hgh Fragment Bodybuilding Supplements and Peptide.

Growth Hormone Releasing Peptides

Growth Hormone Releasing Peptides GHRP-2 5 mgvial&10 mgvial For Bodybuilding &loss fat, CAS: 158861-67-7 Description: GHRP - 2 is a true hGH secretagogue. Which means it stimulates the bodys own secretion of hGH as explained in the study below. Human Growth hormone has been shown in studies to promote lean body mass and reduce adiposity (fat). The group compared ITT to stimulation with GH releasing peptide 2 (GHRP-2). The synthetic hexapeptide, also named pralmorelin, is derived from a metenkephalin peptide. It is the most potent of the family of synthetic GH stimuli known in humans and acts via the endogenous ghrelin receptor (12). As these receptors have been identified both in the hypothalamus and the pituitary, GHRP-2 action may not be restricted to the pituitary.It has been reported that growth hormone (GH)-releasing peptide-2 (GHRP-2), a ghrelin receptor agonist, has an anti-inflammatory effect.
View Complete Details

Growth Hormone Releasing Peptides

Growth Hormone Releasing Peptides GHRP-6 5 mgvial&10 mgvial For Bodybuilding &loss fat CAS No.:87616-84-0 There are two separate categories of growth hormone peptides, we discussed this briefly in my last article. These two categories fall into what we call GHRH (growth hormone releasing hormones) and GHRP (growth hormone releasing peptides). GHRH will increase the amount of growth hormone that can be secreted at the bodys natural timing, and GHRP will target a pulse that forces the pituitary to secrete growth hormone that you have stored. In this article we will be focusing on a specific GHRP named GHRP-6 (Growth hormone releasing hexapeptide).
View Complete Details

Ghrp Releasing Peptide

Ghrp-6 5mg10mg Releasing Peptide Ghrp-6 for Muscle Building & Fat Loss Product Description Anabolic Steroids Supplements Peptide Sermorelin Ipamorelin Ghrp-6 Quick Detail:1.Place of Origin: China 2.CAS No.: 86168-78-7 3.Molecular Formula: C149H246N44O42S4.Assay: 99% 5.Molecular Weight:3357.886.Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH27.Appearance: White Lyophilized Powder8.Storage: Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18 C. Upon reconstitution of the peptide it should be stored at 4 C between 2-21 days and for future use below -18 C. contact:Skype:sales05_267Email: sales05@ycphar.comwhatsApp:+8618872220733 Description:Sermorelin, sometimes called GRF 1-29 NH2 with sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2, is an amidated synthetic 29-amino acid polypeptide that corresponds to the aminoterminal segment of the naturally occurring human hormone releasing hormone(GHRH or GRF) consisting of 44 amino acid residues. It is used as a test for hormone secretion and often used extensively in anti-aging therapy in conjunction with testosterone in men.
View Complete Details

Cjc

Purity 99% Cjc-1295 Without Dac for Weight Loss Cjc-1295 Product Description Cjc-1295 Without Dac Raw Cjc-1295 For Reduce Body Fat Cjc-1295 DAC 863288-34-0 CJC-1295 Without DAC CJC-1295 Without DAC Alias: CJC-1295 Acetate; CJC1295(Without DAC);CJC-1295 Without DAC Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2CJC-1295 Without DAC Cas No.: 863288-34-0CJC-1295 Without DAC Molecular Formula: C165H271N47O46CJC-1295 Without DAC Molecular Weight: 3649.30CJC-1295 Without DAC Purity (HPLC): 98.0%CJC-1295 Without DAC Appearance: White powderCJC-1295 Without DAC Single Impurity(HPLC): 1.0%ACJC-1295 Without DAC mino Acid Composition: 10% of theoreticalCJC-1295 Without DAC Peptide Content(N%): 80%(by %N)CJC-1295 Without DAC Water Content(Karl Fischer): 6.0%CJC-1295 Without DAC Acetate Content(HPIC): 15.0%CJC-1295 Without DAC MS(ESI): NACJC-1295 Without DAC Mass Balance: 95.0105.0%
View Complete Details

Human Growth Hormone Hgh Fragment Bodybuilding Supplements

Human Growth Hormone HGH Fragment 176-191 Bodybuilding Supplements For Weight Loss Details: Name:HGH Fragment 176-191 ApparanceLwhite powderPackage:2mgvialMOQ:10vivalskit HGH Frag 176-191 is a fragment of the HGH peptide. Scientists found that if they truncated the peptide at the C terminal region they could isolate the fat loss attributes associated with HGH. Taking this fragment from HGH, including the peptide bonds from 176-191, they found they had developed a peptide that regulated fat loss 12.5 times better than regular HGH. HGH Fragmen 176-191Fig 1. HGH Fragment 176-191 Chemical StructureIntroduction There is no question as to why bodybuilders of the modern era utilize human growth hormone. Its ability to regulate fat loss, pack on size and increase IGF-1 levels is just a few of the many attributes that many seek. HGH Frag 171-191 was developed so that bodybuilders and athletes not looking for the growth properties from HGH could still reap all the results of its amazing fat loss properties.
View Complete Details
Tell Us What are you looking for? Will call you back

Contact Us