Ghrp Releasing Peptide

Ghrp-6 5mg10mg Releasing Peptide Ghrp-6 for Muscle Building & Fat Loss
Product Description
Anabolic Steroids Supplements Peptide Sermorelin Ipamorelin Ghrp-6
Quick Detail:
1.Place of Origin: China
2.CAS No.: 86168-78-7
3.Molecular Formula: C149H246N44O42S
4.Assay: 99%
5.Molecular Weight:3357.88
6.Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
7.Appearance: White Lyophilized Powder
8.Storage: Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18° C. Upon reconstitution of the peptide it should be stored at 4° C between 2-21 days and for future use below -18° C.
contact:
Skype:sales05_267
Email: sales05@ycphar.com
whatsApp:+8618872220733
Description:
Sermorelin, sometimes called GRF 1-29 NH2 with sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2,is an amidated synthetic 29-amino acid polypeptide that corresponds to the aminoterminal segment of the naturally occurring human hormone releasing hormone(GHRH or GRF) consisting of 44 amino acid residues. It is used as a test for hormone secretion and often used extensively in anti-aging therapy in conjunction with testosterone in men.